SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016300 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016300
Domain Number 1 Region: 36-327
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.91e-90
Family Amylase, catalytic domain 0.000000000087
Further Details:      
 
Domain Number 2 Region: 328-422
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.21e-26
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016300   Gene: ENSECAG00000018500   Transcript: ENSECAT00000019883
Sequence length 425
Comment pep:known chromosome:EquCab2:X:79765283:79774259:-1 gene:ENSECAG00000018500 transcript:ENSECAT00000019883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTMNLRSRAQLLGCVLGLRSLALVLWGIPGARALDNGLAMTPTMGWLHWERFMCNTDC
EEDPDSCVSEKLFMQMADLMDSEGWRDVGYEYLCIDDCWMAPQRDSKGRLQADPKRFPGG
IRRLADYVHGKGLKLGIYADVGKLTCAGFPGSYGYYDIDAKTFADWGVDLLKFDGCHFDT
LVDLADGYKYMSLALNRTGRSIVYSCEWPLYMMPFRKPNYTEVREYCNHWRNFADIYDAW
QSVKSVLDWTSSNQEKIVDAAGPGGWNDPDMLVIGNFGLSWDQQITQMALWAIMAAPLFM
SNDLRQISPQAKALLQDKDVIAINQDPLGKQGYRLRKEDNIEVWERPLSDFAWAVAMVNL
QEIGGPRFHTISLASLGGGLACLPACLITELLPVKGKLGFYEWTSSLKLRINPTGTVLLR
LDRTN
Download sequence
Identical sequences F7B6D0
ENSECAP00000016300 9796.ENSECAP00000016300 XP_001492699.3.31192 XP_008507937.1.77740 ENSECAP00000016300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]