SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016641 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016641
Domain Number 1 Region: 214-347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-21
Family SPRY domain 0.00077
Further Details:      
 
Domain Number 2 Region: 82-115
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000376
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016641   Gene: ENSECAG00000018987   Transcript: ENSECAT00000020281
Sequence length 353
Comment pep:known chromosome:EquCab2:20:28824819:28830185:-1 gene:ENSECAG00000018987 transcript:ENSECAT00000020281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWRDSRRLRLKSEAGPGEGQKSKVNAGDGERGIDSASSRGGPPSAHSKAVPVVAEGTASR
RWLPMEAPELGPGLVERLELLATCPLCGGPFEDPVLLACEHSFCRACLARRWGTPPATGT
EASKRPCSLVGLPSCVRAGLRSCFRPLKERKGHERRERMRGKGSTGDKEPRAHIHVFFCP
FQDMRQTWRRFDAPTPKSSNSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRRLLISEDR
RSVQLAPPGTPAPPDGPARFDQLLAVLGAQGFRAGRHCWEVETSDAASSRDSSGEEEDDG
ESRYAVGAAGESVRRKGVGLCPAEPVSPVEGRSGRLWALTAPEPTPLGGARAP
Download sequence
Identical sequences F7B0U8
ENSECAP00000016641 ENSECAP00000016641 9796.ENSECAP00000016641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]