SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016679 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016679
Domain Number 1 Region: 391-567
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.04e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 569-669
Classification Level Classification E-value
Superfamily E set domains 7.31e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016679   Gene: ENSECAG00000018997   Transcript: ENSECAT00000020322
Sequence length 917
Comment pep:known chromosome:EquCab2:22:39230517:39368456:-1 gene:ENSECAG00000018997 transcript:ENSECAT00000020322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPSARADGGDAPGHEPGGSPQDEFDFSMLFDYVYLNPIEEEPNAHKVASPPSGLAYPD
DVLDYGLKPYSPLASLSGEPPGRFGEPDRGGPQNFLSPAKPAGASGLSPRIEITPSHELM
QAGGPLRGRDTGLLVEQPPLPGVAASPRVTLPVPGFEGYREPLCLSPASSGSSASFISDT
FSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPA
SRSSSPGAKRRHSCAGPLVAPLPGASPQRSRSPSPQPRDDGAPAGYPPTAGSAVLMDALN
SLAADSPCGIPPKMWKTSPDPSPVSAAPSKAGLARHIYPAVEFLGPCEQEERRNSAPESI
LLVPPTWPKQLVPALPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYETEG
SRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTS
YEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRV
HIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESK
VLFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTSVKVNFYVINGKRKRS
QPQHFTYHPVPAIKTEPTDEYNPTLVCSPGHGGLGSQPYYPQHPMVAESPSCLVATMAPC
QQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLALADAHRSVLVHA
GSQGQGSAALHPSPAGQQASPVIHYPPAGPQLRCGGRQEFQHIMYCENFAPGSARPGPPP
AGQGQRLSPGAYPTVIQQQNAPSQRAAKNGPPVSDQKEVLPTGVIIKQEQNLDQTYLDDV
NEIIRKEFSGPPARNQT
Download sequence
Identical sequences F7AUN7
9796.ENSECAP00000016679 ENSECAP00000016679 ENSECAP00000016679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]