SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016857 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016857
Domain Number 1 Region: 696-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-66
Family Protein kinases, catalytic subunit 0.0000112
Further Details:      
 
Domain Number 2 Region: 374-661
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-48
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 230-355
Classification Level Classification E-value
Superfamily SH2 domain 2.49e-16
Family SH2 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1-89
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000262
Family Second domain of FERM 0.0043
Further Details:      
 
Domain Number 5 Region: 174-234
Classification Level Classification E-value
Superfamily PH domain-like 0.0000016
Family Third domain of FERM 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016857   Gene: ENSECAG00000018673   Transcript: ENSECAT00000020532
Sequence length 967
Comment pep:known chromosome:EquCab2:5:95689196:95725590:1 gene:ENSECAG00000018673 transcript:ENSECAT00000020532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEF
NNKTICDSSVSMHDLKVKYLATLETLTKHYGAEIFETSELLISSENEMNRFHLNDSGNIL
YYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKYKKDEEKNKIREEWNNFSYFPE
ITHVVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPL
IVHNIQNGCHGPICTEYAINKLRQEGGEEGMYVLRWSCTDFDNILMTVTCFEKSEQVLGG
QKQFKNFQIEVQKGCYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLKRCCQPKPREI
SNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGTLVDYRDDEGT
PEEKRIKVILKVLDPSHRDISLASAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEF
VEGGPLDLFMHRKSDVLTTPWKFNVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDS
ECGPFIKLSDPGIPITVLSRQERLERIPWIAPECVDDSKNLSVAADKWSFGTTLWEICYN
GEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLE
EQNPDIVSERKPAAEVDPTHFEKRFLKRIRDLGEATGHFGKVELCRYDPEGDNTGEQVAV
KSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEY
LPKNKNKINLKQQLKYAVQICKGMDYLGSQQYVHRDLAARNVLVESEHQVKIGDFGLTKA
IERDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDSSPMAL
FLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPHCPDEVYQLMRKCWEFQPSSRTTFQNLIE
GFEALLK
Download sequence
Identical sequences F7BLR3
ENSECAP00000016857 ENSECAP00000016857 9796.ENSECAP00000016857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]