SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017078 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017078
Domain Number 1 Region: 17-414
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-116
Family Amylase, catalytic domain 0.000000000000789
Further Details:      
 
Domain Number 2 Region: 420-510
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.03e-35
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017078   Gene: ENSECAG00000019367   Transcript: ENSECAT00000020784
Sequence length 511
Comment pep:known chromosome:EquCab2:5:63087428:63095632:-1 gene:ENSECAG00000019367 transcript:ENSECAT00000020784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLLLSAIGFCWAQYDPHTQSGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENIVVNNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVVNHMCGS
GGGAGTSSTCGSYYNAGSRDFPAVPYSGWDFNDGKCNSGSGEVENYNDIYQVRDCRVVGL
LDLALEKDYVRSTIADYLNHLIDLGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTNWFPQG
SKPFIYQEVIDLGTEPIKGSEYFGNGRVTEFKYGAKLGTVLRRWDGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRIMSSYRWA
RNFQNGQDANDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQA
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPGGTYCDVISGDKVDGNCTGI
KIYVSSDGSAYFSISNTAEDPFIAIHAESKL
Download sequence
Identical sequences F7DYB1
9796.ENSECAP00000017078 ENSECAP00000017078 ENSECAP00000017078 XP_001487909.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]