SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017377 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000017377
Domain Number - Region: 205-216,261-373
Classification Level Classification E-value
Superfamily YWTD domain 0.0068
Family YWTD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017377   Gene: ENSECAG00000019919   Transcript: ENSECAT00000021118
Sequence length 417
Comment pep:known chromosome:EquCab2:1:139028634:139053897:-1 gene:ENSECAG00000019919 transcript:ENSECAT00000021118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRVMVDLCNSTKGICLTGPPGPPGPPGIGGLPGHNGSDGQPGPQGLKGEKGANGKRGKMG
LPGAPGNPGEKGDPGELGLTGNEGPAGQKGEKGDKGDVSNDVLPAGAKGPPGPPGPPGPP
GPPGPPGSRRSKGSRQPNMFNGQCSGETCAVPNDDTLVGKADEKVNEHHSPQAESMIASI
GNPMQVLEVTETFGTWIRESANKSDERIWVTEHFSGTKVKGHLADTLHLSMTLVILPQRD
KGSGHTHCIHSSWYRPGGGHAGTLFEFGKETSQTLKLENALYFDRKYLFANSKTYFNLAV
DEKGLWIIYASSVDGSSILVAQLDERTFSVVQHINTTYPKSKAGNAFIARGILYVTDTKD
MRITFAFDLLGGKQINANFDLRTSQSVLAMLSYNMRDQHLYSWEDGHLMLYPVQFLS
Download sequence
Identical sequences F7DXN3
ENSECAP00000017377 9796.ENSECAP00000017377 ENSECAP00000017377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]