SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017514 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017514
Domain Number 1 Region: 358-551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 82-184
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000019
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000465
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017514   Gene: ENSECAG00000019958   Transcript: ENSECAT00000021274
Sequence length 1191
Comment pep:known chromosome:EquCab2:7:19277197:19391449:-1 gene:ENSECAG00000019958 transcript:ENSECAT00000021274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMSPQQETLGGQPGRSSSLTGVSRLAGGPGTKKKMKTLAERRRSAPSLILDKALQKRP
STKESPSASMDTCAFLSSFVCSSRTLLIDGRVELKRGLQRQERHLFLFNDLFVVAKIKYN
NNFKIKNKIKLSDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVTNSDTVNEVINMSLPMLGISGSER
DYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDTALLTQGSKDSTAPSNLQEPFLMEQLP
RAMQCQFILKPSRLAAAQQLSDSGQKTFKRRRSIINWAFWRGSSIHLDNLPVSPTSPMSG
QLFGVSLPHICENDNLPKPVLDMLCFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVCVMDQGNDEEKINTIQRLLDQLPRA
NVVLLRYLFGVLHNIEQQSSSNQMTAFNLAVCIAPSILWPPTSSSPELENEFTKKVSLLI
QFLIENCCRIFGEEITSLLGEVSVRCDARENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLDHSKDEDIQMERPLESKPV
NITVMYTKGRLQDHARAPSAMSTPSYLSTAAADAPKSLRRHRRCSEPSIDYLDSKLSYLR
EFYQKKLRKSSCDAILSQKDEEYLKQNQPLQEEGKTCFKKSLVTGTDIKKNATNKNVKKK
GISGNEGNHVKLFPKSKPVAISVASCSHMSSHDHPRSQPFEADASGYSPPHTADALKSSR
RHRRCSEPSIDDQHYKLTYLRGFYSKKQHKTSYESSLLHGEEDYLKRHKSLQMEGQKLIN
QSLVMGIEVGKSSATNQNTEKILPPRLNICPRTSYSSLSSPGTSPSGSSVSSQDSAFSQI
SEHSVFTPTETSSPIDCTFQAQRKQEELSSDFSSSSLISGMPGPSSGQASSHLAYTKKDS
VEWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAYRPEEKKTGSLQGPMEVPPHASGV
PEANSLQERQKDVPLRAAKGLGAVQTAQRYNSQPSQDSEKHCCSPFTLVEDRLKLCTQSH
EEGEISGQCSPGARPCEQSSPSSLTVDDVTSPDSGPTVVCDVGDRHLTKDI
Download sequence
Identical sequences F7CR33
ENSECAP00000017514 9796.ENSECAP00000017514 XP_001499947.2.31192 ENSECAP00000017514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]