SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018302 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018302
Domain Number 1 Region: 315-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.33e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000123
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018302   Gene: ENSECAG00000020326   Transcript: ENSECAT00000022165
Sequence length 957
Comment pep:known chromosome:EquCab2:6:34597086:34621970:1 gene:ENSECAG00000020326 transcript:ENSECAT00000022165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLLLPLLLASLLPSSSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDG
ANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQI
CYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGTA
GLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGISFDPALIHDNGLIH
PPRREPALMIGACWAEEKNKEKEKGGDNSTDTTQGDPLPIHHYFHGYLAGFSVRSGRLES
REVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTL
RFATPGVRPLRLTTAVKCFSEESCVSIPDVEGYVVVLQPDAPQILLTGTAHFARPAVDFE
GPEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDP
ERESLLLDMASLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYARKFR
LSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSH
RNSMVPSAATLIIVVCVGFLVLMVILGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDD
SALTIIVNPMESYQNRQAHVAGAAGGQQEDEDSSDSEAADSPSSDERRIIETPPHRY
Download sequence
Identical sequences F6VJD0
ENSECAP00000018302 XP_001498149.1.31192 ENSECAP00000018302 9796.ENSECAP00000018302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]