SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019464 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019464
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 68-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019464
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00435
Family SCAN domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019464   Gene: ENSECAG00000022039   Transcript: ENSECAT00000023494
Sequence length 523
Comment pep:known chromosome:EquCab2:2:17664676:17676255:-1 gene:ENSECAG00000022039 transcript:ENSECAT00000023494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQRLLITLPTEASTWVKLHHPKMAKEGAPLWEDVTKMFEGEALLSPDADETQGESLKDE
VTSGPLTAKSQELLTFKDISVDFTQEEWGQLAPGHRNLYREVMLENYGNLVSVGYQLSKP
SVISLLEKGEEPWITEKEGSGDPSSDLKSKPETNISTAKNDILQEELCHGIMMERLMRDD
VIYSTLRKVSKCDDELERHQETHRRDVSQAISIHKKRGQETNKFGENVVSSNVVIKQRHR
KCDTLRKRNRFKLDMINHPTSYIRTKTYECTICEKIFKQPIHLTEHMRIHTGEKPFRCKE
CGRAFSQSASLTTHQRIHTGEKPFECEECGKTFRHRSSLNQHHRTHTGEKPYVCDKCQKA
FSQNISLIQHLRTHSGEKPFTCHECGKTFRQVRHLSEHIRIHTGEKPYACTACCKTFSHR
AYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECSRCGKAYRHDSSFK
KHQRHHTGEKPYECNECGKAFSYNSSLTRHHEIHRRNAFRNSV
Download sequence
Identical sequences F6YET1
ENSECAP00000019464 ENSECAP00000019464 9796.ENSECAP00000019464 NP_001296115.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]