SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020050 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020050
Domain Number 1 Region: 742-969
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-59
Family DBL homology domain (DH-domain) 0.000000000874
Further Details:      
 
Domain Number 2 Region: 348-524
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-56
Family Regulator of G-protein signaling, RGS 0.0000000243
Further Details:      
 
Domain Number 3 Region: 973-1107
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-43
Family Pleckstrin-homology domain (PH domain) 0.000000279
Further Details:      
 
Domain Number 4 Region: 26-119
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020050
Domain Number - Region: 147-157
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020050   Gene: ENSECAG00000022117   Transcript: ENSECAT00000024151
Sequence length 1560
Comment pep:known chromosome:EquCab2:5:41344285:41389891:1 gene:ENSECAG00000022117 transcript:ENSECAT00000024151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMCFSYSFSRLNSLSLGDSAPERKSPSHHRQSSDTSETTGLVQRCVIIQKDQHGFGFTVS
GDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGS
SPASIGVSALQQDPAPAGAPRVTPVIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQIL
RNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLYGD
TSQRSSEGRLSLDSQEGDSGLDSGTERFPSLSESLVNRNSVLSDPGLDSPRTSPVIIARA
AQHHRRQGSDAPVPSTSDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPA
HLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKLPEV
LQAEIDLRLRSGEDMRGVLCEAQEAALPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGD
PLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPASTAEKAQSA
PDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSIKPGNVRNIIQHF
ENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENVPR
SRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRKSIESPSLGFCTDAL
LPHLLEDDLGQLSDLEPELDAQNWQHTVGKDVVSGLTQREIDRQEVINELFVTEASHLRT
LRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMRKLREEGPIIKEISDL
MLARFDGSAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLR
DLIISEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHR
LEGYQKRLDTTSLERASNPLAAEFKSLDLTARKMIHEGPLTWRISKDKTLDLHVLLLEDL
LVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELG
PPQIYELVALTSSDKNTWMELLEEAVRHATRHPGAAPTPIHPPPPGPQEPTHPSPTASRA
GLDDSEMFPAEPEPEELPGGTGPQQRVKGKHPVMLEAPEQPGRVEEEEVRALPHPAASLD
VENRASRTRDPILLPLPDPLFMEGLASSLEDVENLQHLILWSLLPGHSVEPQAAREPEDD
LTPTPSVISITSHPWDPGSPGPAPTGGEGDNTQLPGPEGGRPEQEDVALCSLEHLPPRTR
NSGIWESPELDRNPEEETSSTEAAGSYKVVRKGASLPNGSFLPAFVAGSKVVPALPESGQ
SEPEPPEVEGGAKATGNCFYVSMPAGPLDSSSDPSEVPTNPSQPDSLPAWQTEPRPQRLG
SNEDQRRPGHSPPSLALRDVGLIFRTIEQLTLKLNRLKDMELAHRELLRSLGGESSGGTT
PVGSFHTEAARWTNSTLSPPAKEPLASDSRDSQELGPCPEDGSDTPLEDSTAEAATSPGL
Download sequence
Identical sequences F6ZDY4
9796.ENSECAP00000020050 ENSECAP00000020050 ENSECAP00000020050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]