SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020243 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020243
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily BPTI-like 6.24e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020243   Gene: ENSECAG00000022840   Transcript: ENSECAT00000024373
Sequence length 96
Comment pep:known chromosome:EquCab2:22:34716950:34718657:1 gene:ENSECAG00000022840 transcript:ENSECAT00000024373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAELRFLLGLFILFLLTTQLMGGVTRLTEMICGELKDPCNMDLKLGSCYEVHFRYFYN
KTSKRCESFVYTGCDGNLNNYKLIIDCNIACVEAYQ
Download sequence
Identical sequences F6UPY6
ENSECAP00000020243 9796.ENSECAP00000020243 ENSECAP00000020243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]