SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020276 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020276
Domain Number 1 Region: 4-471
Classification Level Classification E-value
Superfamily Sema domain 1.11e-160
Family Sema domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 472-525
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000837
Family Plexin repeat 0.00093
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020276
Domain Number - Region: 538-604
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0733
Family C1 set domains (antibody constant domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020276   Gene: ENSECAG00000022668   Transcript: ENSECAT00000024410
Sequence length 784
Comment pep:known chromosome:EquCab2:1:93210149:93219114:-1 gene:ENSECAG00000022668 transcript:ENSECAT00000024410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEERPFLRFEAENISNYTALLLSKDGETLYVGAREALFALNSSVSFLPDGGYQELLWSAD
ADRKQQCSFKGKDPQRDCQNYIKILLPLNSSHLFACGTAAFSLVCTYINVENFTPARDEA
GNILLEDGKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSHRPTKTESSLN
WLQDPAFVASAHIPESLGSSQGDDDKIYFFFSETGQEFEFFENTIVSRIARICKGDEGGE
RVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQEWHDTLFYGVFTSQWHRGTT
EGSAVCVFTMKDVQRAFNGLYKEVNRETQQWYTVTHAVPTPRPGACITDSARERKISSSL
QLPDRVLNFLKDHFLMDGQVRSHLLLLQPEARYQRVAVHRVPGLHRTYDVLFLGTSDGRL
HKAVGVGPRMHIIEELQIFSPGQPVQNLLLDTNGGLLYAASHSGVVQVPVANCSLYQSCG
DCLLARDPYCAWSGSSCRLASLYQPEAASRPWIQDIEGANTRDLCNTSSARPRSSAPTGE
EPCEQVLFQPNTVNTLACPLLSNLATRLWLHNGVPINASASCRVLPTGDLLLVGSQQELG
HFQCWSLEESFQQLVTSYCPKVIEDMGDQGDHSGSVPVIINTSRVSAPASGKVSWSVDKS
YWTEFLVMCTLFVFAVVLLILFFLYRHRGGMKVFLKQGECASVHPKTRPVVLPPETRPLN
GVGPPSTPLDHRGYQALSDSSPGPRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIR
DSVV
Download sequence
Identical sequences F6UP61
9796.ENSECAP00000020276 ENSECAP00000020276 ENSECAP00000020276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]