SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020619 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020619
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-21
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020619   Gene: ENSECAG00000023134   Transcript: ENSECAT00000024799
Sequence length 497
Comment pep:known chromosome:EquCab2:20:38732413:38769851:-1 gene:ENSECAG00000023134 transcript:ENSECAT00000024799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLRLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTAIFIVWGVLVHLVIPPF
VFMVTEEWDYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKTLQMTGSAGSKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTGGGGERVPGLGPQGVGLPALPTSLAPLVVYSKNRVPTLEEVTQTL
RSKGHVSRTPSEEAGAGPPEDGTPTSEVFINQLDRISEEGEPWDAQDYHPLIFQNASITF
VNEETGLSDEETSKSSLEDNLAGEERPQEGPKAEVPLNLGEFPSSDESTFTSTESELSVP
YEQLMNEYNKADGSKGT
Download sequence
Identical sequences F6VJB9
9796.ENSECAP00000020619 ENSECAP00000020619 XP_001500661.1.31192 XP_008516242.1.77740 XP_014686454.1.49734 ENSECAP00000020619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]