SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021044 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021044
Domain Number 1 Region: 306-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-23
Family Glycosyl hydrolases family 16 0.091
Further Details:      
 
Domain Number 2 Region: 122-228
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000108
Family Cadherin 0.0046
Further Details:      
 
Domain Number 3 Region: 10-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000842
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021044   Gene: ENSECAG00000023111   Transcript: ENSECAT00000025300
Sequence length 951
Comment pep:known chromosome:EquCab2:2:41462031:41494363:1 gene:ENSECAG00000023111 transcript:ENSECAT00000025300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIH
GQNVPFDAVVVDKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGANVKKSHKATV
HIQVNDVNEYAPVFKEKSYKATVVEGRQYDSIVRVQAVDADCSPQFSQICSYEIVTPDVP
FAVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKPACTPGWQGWNN
RIEYEPGTGALALFPNVHLETCDESVASVQATVELETGHIGKGCDRDTYSEKSLHRLCGA
VSGTAELLPSPGGSLNWTVGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSINPKEPLTISV
WMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLVFLLRQDPSEEKKYKPAEFHWKL
NQVCDEDWHHYVLNVEIPRVTLYVDGVSHEPFSVTEDYPLHPSKIETQLVVGACWQEYSG
VENDNETEPVPVASAGGDLHMTQFFRGNLAGLTIRSGKLEDKKVIDCLYTCKEGLDLPVP
EDSGRGVKIQANPSQSVLTLEGEDVGELDKAMQHVSYLNSRQFPTPGIRRLKITSTVKCF
NEAACISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIISTITR
EVEPEGEGDEDPTVQESLVSEEIVHDLDTCEVTVEGEELNPEQESLEVDMAHLQQKGIEV
SSSDLGMIFTGVDSMASYEEVLHLLRYRNWHTRSLLDRKFKLVCSELNGRYVSNEFQVEV
NVIHTANPVEHANHMAAQPQFVHPEHRSFVDLSGHNLANPHPFAVVPSTATVVIVVCVSF
LVFMIILGVFRIRAAHQRTMRDQDTGKENEMDWDDSALTITVNPMETYEDQHSSEEEEEE
EEEESEDGEEEDDITSAESESSEEEEGGEHGDQQNVNRQQQLEWDDSTLSY
Download sequence
Identical sequences F7CQ80
ENSECAP00000021044 9796.ENSECAP00000021044 ENSECAP00000021044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]