SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021296 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021296
Domain Number 1 Region: 141-337
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-54
Family Reprolysin-like 0.00036
Further Details:      
 
Domain Number 2 Region: 355-431
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.96e-19
Family Blood coagulation inhibitor (disintegrin) 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000021296
Domain Number - Region: 575-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021296   Gene: ENSECAG00000023769   Transcript: ENSECAT00000025594
Sequence length 687
Comment pep:known chromosome:EquCab2:27:5771952:5952681:1 gene:ENSECAG00000023769 transcript:ENSECAT00000025594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQISYIIPIDEKPYTVHLKQRFFLAHNFMAYLYKEGSMNSYSSNVQTQCYYQGHIEGYPS
SVVTLSTCSGLRGILQFENVSYGIEPLEYTEEFQHLLYKLRNENNGLAVLTENNRGIEQN
PRAYNFFISEKSESAVPDLIPLYLEVHIVVDKVLYDYLGSDSMIITNKIIEIIGLVNSMF
AQFNVTVVLSSLELWSDKNKISTVGEADELLSRFSDWKKSYLTLRPHDIAYLFIYKDYPD
YVGATFPGKMCITHYSAGIALYPKEITLEAFSVIFTQMLGISLGISYDDPKKCQCSGAVC
IMNPEAIQYSGVKTFSSCSLSDFENFVSKMGARCLQNKPQMQASAQSTCGNRRVEGREVC
DCGTVEQCGPLTCCDPPTCTLKAGAQCHEGLCCKSCNISGRGVLCRPTAHSECDLPEYCD
GVSPQCPPDITFHDGKLCKGEYFCYGGECQDLDARCQSLFGAGSRNAPFACYEEIQNHND
RFGNCGKKSGRYIFCGWRNLICGKLICTYPSTKPYYQENGAVIYAFVRNTICITLDLQVN
DPDPMLVHSGAICDDGRLCVDRQCVEARFLQSQLHNCSAKCHGNGVCTSNLTCHCKSGYN
PPDCQTRSRESSRLPGKQSKSCLIMERAFRKAEKNWWFLGLYIGLPVLVIASIIAVVWNN
LKKWLTKEEEALSSKSYSEGSTHTYAS
Download sequence
Identical sequences F6Y8R1
ENSECAP00000021296 ENSECAP00000021296 9796.ENSECAP00000021296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]