SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021463 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021463
Domain Number 1 Region: 10-33,73-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-24
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Domain Number 2 Region: 158-260
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.41e-21
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021463   Gene: ENSECAG00000024032   Transcript: ENSECAT00000025781
Sequence length 372
Comment pep:known chromosome:EquCab2:9:78899452:78984365:-1 gene:ENSECAG00000024032 transcript:ENSECAT00000025781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRDLSIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQ
LELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLT
LVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCIGAAFSQCE
EWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLV
VLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEARQGRPRYKADVADLQSVCSCTCY
RPQEYGGRSAAHQNSVSAKLAPQYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFT
DNHRLMRRRKSI
Download sequence
Identical sequences F6Z4G1
9796.ENSECAP00000021463 ENSECAP00000021463 ENSECAP00000021463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]