SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022044 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000022044
Domain Number - Region: 64-110
Classification Level Classification E-value
Superfamily E set domains 0.0252
Family RhoGDI-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022044   Gene: ENSECAG00000024402   Transcript: ENSECAT00000026429
Sequence length 1165
Comment pep:known chromosome:EquCab2:9:67160084:67214588:-1 gene:ENSECAG00000024402 transcript:ENSECAT00000026429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILTMLDFLADNNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIF
DFSYFKGPELWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDL
NEGVYIQHTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIDGEVRERMLVSYYRYSAAR
SSADSNMDDICKLLRSTGYSSQPGAKRPPNYPESYFQRVPINESFINMVIGRLRSDDIYN
QVSAYPLPEHRSTALANQAAMLYVILYFAPSILHTHQAKMREIVDKYFPDNWATVISIYM
GITVNLADAWEPYKAAKTALNNTLDLSNVREQASRYATVSERMRAQVQQFLKEGYLREEM
VLDNIPKLLNCLRDCNVSIRWLMLHTADSACDPNNKRLRQIKDQILTDSRYNPKILFQLL
LDTAQFEFILKEMFKHMLSEKQAKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQA
WFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQM
IRTINIKEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALD
LPLLRINQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPT
RLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKEL
VKRVAFALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEV
SRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDP
KMTCHIDQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSM
FQKIILRDRTVQDTLKTLMNAVSPLKSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQM
QILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEIT
AYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWP
PLVLGLLTLLKQFHSRYTEQFLALIGQFIRSTVEQCTSQKIPEMPADVVGALLFLEDYVR
YTKLPRRVAEAHVPNFIFDEFRTVL
Download sequence
Identical sequences F6RQ92
9796.ENSECAP00000022044 ENSECAP00000022044 ENSECAP00000022044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]