SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022647 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022647
Domain Number 1 Region: 722-779
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000111
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 28-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000157
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022647   Gene: ENSECAG00000025078   Transcript: ENSECAT00000027072
Sequence length 779
Comment pep:known chromosome:EquCab2:8:1316427:1322900:-1 gene:ENSECAG00000025078 transcript:ENSECAT00000027072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLPWALLLLVTAPSPGRWPAADAQESCSHRCGEWNELCSCHPTCFGLDSCCKDFRD
FCLEILPYSGSMMGGKDFVVQHLNWFSPTDGVICRFNESVQTRGHVDSLGHVHCVSPLLY
ETGRIPFTLSMDNGSSFPRSGTWLAVHPSKVSQTEKLQLENETRWQYYGTAGTKGNLTLT
WNTAALPTQSVTIELWGYEETGKPYSEDWTAKWSYLYALATNVSNSGFFTFTPEPAPQNY
QRWEVGALRIINSEYHSGEKDVHALWSNEHALAWHLGDDFRADPVAWARTQCLAWEELED
QLPNFLEELPDCPCTLAQARSDSGRFHTDYGCDIEHGSECTYHPGAVHCVRSVQASPQYA
SGQQCCYTAAGTQLLTADSMGGSTPDRGHDWGAPPFRAPPRVPGLSHWLYDVISFYHCCL
WAPECSRYMRRRPSSDCRSYRPPRLASAFGDPHFVTFDGANFTFNGHGEYVLLEASLTNL
TVQARAQPDTTPEGTQARGTGLTAVAVQEGDSDVVEVRLAGGAGVLQVLLNQEVLSFAEQ
SWMDLKGMFLSVAAEDRVSIMLSSGAGLEVSIQGPFLSVTVLLPEKFLTYTQGLLGTLND
NFTDDFTLRSGQVLPPDASSQELFQFGADWAVENASSLLTYDSQLLVNNFLYGPKHDPTF
RPLFPDEITPNSSQTTEVAKLCGDNHFCSFDVAATGSLSVGNATRMAYQLHQRRVQSLQS
VVSCGWLAPPLNGHKDGMRYLVGSTIHFHCDTGYSLAGAEASTCQANGTWSTPTPTCQP
Download sequence
Identical sequences F6QE14
ENSECAP00000022647 ENSECAP00000022647 9796.ENSECAP00000022647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]