SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022677 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022677
Domain Number 1 Region: 27-489
Classification Level Classification E-value
Superfamily Sema domain 2.35e-125
Family Sema domain 0.0000515
Further Details:      
 
Domain Number 2 Region: 1329-1458,1653-1842
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family p120GAP domain-like 0.022
Further Details:      
 
Domain Number 3 Region: 1020-1125
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000194
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 4 Region: 838-935
Classification Level Classification E-value
Superfamily E set domains 0.00000000000007
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 5 Region: 933-1022
Classification Level Classification E-value
Superfamily E set domains 0.00000000000399
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 6 Region: 492-542
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000288
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 1123-1202
Classification Level Classification E-value
Superfamily E set domains 0.00000091
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022677
Domain Number - Region: 790-824
Classification Level Classification E-value
Superfamily Plexin repeat 0.000327
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 637-672
Classification Level Classification E-value
Superfamily Plexin repeat 0.0576
Family Plexin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022677   Gene: ENSECAG00000025088   Transcript: ENSECAT00000027107
Sequence length 1872
Comment pep:known chromosome:EquCab2:X:122766185:122778671:1 gene:ENSECAG00000025088 transcript:ENSECAT00000027107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVCLLSLLVLAMGGALGSSRPFPAFSVTDTTLTHLAVHRVTGEVFVGAVNRVFKLSPN
LTELRAHVTGPVEDNARCYPPPSMRVCAHRLAPVDNVNKLLLIDYAARRLVACGSIWQGI
CQFLRLDDLFKLGEPHHRKEHYLSGAREPDSMAGVIVEQGQGPSKLFVGTAVDGKSEYFP
TLSSRKLIGDEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYIYGFVSASFVYFL
TLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAK
PGLLLAQALGVPADEDVLFTVFSQGQKNRASPPRQTILCLFTLSNINAHIRRRIQSCYRG
EGTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAA
YTYHQHSVVFIGTRSGSLKKVRVDGSQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLS
EKQVSQLPVETCEQYLSCAACLGSGDPHCGWCVLQHRCCREGACPGASAPHGFAKELSKC
VQVRVQPNNVSVTSPGVQLTVAMRNVPDLSAGVSCAFEEVTENEAILLPSGELRCPSPSL
QELRTLTRGHGATRTVRLQLLSKETGVSFAGADFVFYNCSVLQSCMSCVGSPYPCHWCKY
RHVCTSHPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNY
ECVVRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEYGDTELDFSVVWDGDFPIDKPATF
RALLYKCWAQRPSCGLCLKADPRFNCGWCVSEHRCQLRAHCPAPKTNWMHLSQKGTRCSH
PRIAQIHPLMGPKEGGTRVTIVGENLGLTYREVGLRVAGVRCNSIPAEYVSAERIVCEME
ESLVPSPPPGPVELCVGDCSADFRTQSEQLFSFVTPMFNRVSPSRGPASGGTRLTISGSS
LDAGSRVAVTVRDGECQFVRRDAEAIVCISPVSTLGPSQASITLAIDRANISSPGVLYTY
TQDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLC
KAPGIFLGRPQPQAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVK
PGSHVVLKGKNLIPAAAGNSRLNYTVLIGGQPCALTVSDTQLLCDSPSQTGRQPVMVLVG
GLEFWLGTLHITAERALTLPAMVGLAVGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQ
MDNLESRVALECKEAFAELQTDINELTNHMDGVQIPFLDYRTYAVRVLFPGIEAHPVLKE
LDTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYA
TGLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLL
YCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCLCPESEGSPQVPVKVLN
CDSITQAKDKLLDAVYKGIPYSQRPKAEDMDLEWRQGRMARIILQDEDVTTKIECDWKRV
NSLAHYQVTDGSVVALVPKQVSAYNMANSFTFTCSLSRYESLLRTASSPDSLRSRAPMIT
PDQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFST
AHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH
KSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMA
SISDQDMDAYLVEQSRLHASDFNVLSALSELYFYVTKYRQEVLTALDRDASCRKHKLRQK
LEHIITLLSSNS
Download sequence
Identical sequences F6Q583
ENSECAP00000022677 9796.ENSECAP00000022677 ENSECAP00000022677 XP_003365958.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]