SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022768 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022768
Domain Number 1 Region: 214-391
Classification Level Classification E-value
Superfamily MIR domain 1.13e-50
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1078-1191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-18
Family SPRY domain 0.03
Further Details:      
 
Domain Number 3 Region: 3993-4071
Classification Level Classification E-value
Superfamily EF-hand 0.000000000762
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 656-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 97-179
Classification Level Classification E-value
Superfamily MIR domain 0.00000301
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 418-545
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000209
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2144-2209
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022768
Domain Number - Region: 1409-1530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000281
Family SPRY domain 0.038
Further Details:      
 
Domain Number - Region: 3000-3048,3084-3155,3193-3319,3373-3398,3465-3470,3818-3842
Classification Level Classification E-value
Superfamily ARM repeat 0.025
Family MIF4G domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022768   Gene: ENSECAG00000006795   Transcript: ENSECAT00000029145
Sequence length 4950
Comment pep:known chromosome:EquCab2:1:73898258:74403258:-1 gene:ENSECAG00000006795 transcript:ENSECAT00000029145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKWSCSVLPPSTKSSRSYVWQQKGLATDFVSWSPLQIPRMSPQTSPSAPLCWNSPSPSG
PCRRCWLTRWRSQKGQVDVEKWLFSMQTAQGGSHRTLLYGHAILLRHSYSGMYLCCLSTS
RSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSY
GNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQ
RRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLL
MDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHVNTGLWLTYQS
VDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDAL
SKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMIN
LVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLD
WLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCS
LCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYE
LMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGC
IARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSA
GIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVS
LTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHP
CLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSGY
KPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRVRQGWTYGIQQDVKNRRNPRLVPYA
LLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYAV
KAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDECAFAFDGFKAQRWHQGNEHYGRSW
QAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMN
FGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGT
IDSCPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFSKTAGSGIPGAGLFGPKNDLED
YDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPD
YSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTG
FDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAASG
LLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHK
NPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCMDPLQFMSLHIPEEN
RSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPG
LLRAGYYDLLIDIHLSSYATARLMMNSEFIVPMTEETKSITLFPDENKKHGLPGIGLSTS
LRPRMQFSSPSFVSINNDCYQYSPEFPLDILKAKTIQMLTEAVKQGSLHARDPVGGTTEF
LFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAASPEEESEALEKEPCAEDSKLE
GAGDEEAKEGERPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKL
QDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQL
LDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKPVESDSKKSS
TLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDT
INLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMV
NVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRG
STPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGE
RYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAVMEEAIKIAED
PSRDGPSPTSGSSRTPDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEA
IRIRSILRSLIPLGDLVGVISIGFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVY
GIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFA
GTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDV
PLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKK
YEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEK
LEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIK
ESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRD
LHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFL
QINGYVVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPY
EQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVR
HRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAEDLEKTMENLK
QGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTS
LYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALN
LPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPEN
NPERTEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLK
THFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRF
VDYNRAKWLKEPNPEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTK
SKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRF
SMKDTEDEVRDIIRNNIHLQGKLEDPAIRWQMALYKDLPNRTEDTSDPEKTVERVLDIAN
VLFHLEQVRFCVDSCHFTQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRA
VNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTAL
TEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGA
AEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGL
MQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQN
YLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQV
FNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQK
DMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYD
PDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGF
NVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESS
RTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSA
NKEESEKEKPEEQGPKMGFFSILTVKSALFALRYNILTLMRMLSLKSLKKQMKKVKKMTV
KDMVTAFFSSYWSILMSLLHFVASVFRGFSRIICSLLLGGSLVEGAKKIKVAELLANMPD
PTQDEVRGEGEEGERKPVETALASEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPH
NPNAGLSDLMSNPVPIPEVQDKFQVIYPVAAALWFLDGLYFIRVHRGEDGEKEEKAKEDK
GKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFIL
LFYKVSTSSVVEGKELPIRSSSENAKVSSLESSSPRIIAVHYVLEESSGYMEPTLRILAI
LHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINT
QSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAV
LNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTIL
SSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHM
YVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQ
EQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQE
SYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences F6SEY0
ENSECAP00000022768 ENSECAP00000022768 9796.ENSECAP00000022768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]