SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022929 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022929
Domain Number 1 Region: 54-523
Classification Level Classification E-value
Superfamily Sema domain 1.7e-128
Family Sema domain 0.0000219
Further Details:      
 
Domain Number 2 Region: 1365-1494,1690-1878
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 966-1055
Classification Level Classification E-value
Superfamily E set domains 1.17e-18
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 4 Region: 1054-1157
Classification Level Classification E-value
Superfamily E set domains 3.82e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 870-967
Classification Level Classification E-value
Superfamily E set domains 0.00000000000187
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 6 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000327
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1154-1235
Classification Level Classification E-value
Superfamily E set domains 0.0000000756
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 822-856
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022929   Gene: ENSECAG00000001716   Transcript: ENSECAT00000028938
Sequence length 1909
Comment pep:known chromosome:EquCab2:5:29880722:30063160:1 gene:ENSECAG00000001716 transcript:ENSECAT00000028938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQRICLLVLAPLRMEQRRPWPRAAEVDSWSVVLLSVVWVMLAPQAVSMPQFSTFHSEN
RDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
VLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKT
GTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSL
IKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCK
DDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDSLAQAFNISSQDDVLFAIFSKGQKQ
YHHPPDDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFC
GLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPH
GGVQYEMVSVLKDGSPILRDMAFSIDQRYLYIMSERQITRVPVESCEQYTTCGECLSSGD
PHCGWCALHNMCSRRDKCQRAWEPNRFAASISQCMSLEVHPSSISVSEHSRLLSLLVSDA
PDLSAGIACAFGNLTEVEGQVSGSQVICISPGPKDVPIIPLDQDWFGLELQLRSKETGKI
FVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLV
PTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNS
SYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGW
CSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGL
DFSEIAHHVQVAGVPCTPLPGDYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKS
HQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMNEIV
CVSPPSSNGLGPVPVSVSVDRARVDNNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFN
LDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNN
VQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLV
GETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAG
GSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTS
DLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFL
LTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKL
LLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSL
SEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQR
PRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSY
NIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKE
GDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQAD
RHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTS
EHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFN
MLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Download sequence
Identical sequences F6PTI4
ENSECAP00000022929 ENSECAP00000022929 9796.ENSECAP00000022929 XP_001491498.2.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]