SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189439754|ref|YP_001954835.1| from Bifidobacterium longum DJO10A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189439754|ref|YP_001954835.1|
Domain Number 1 Region: 189-258
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000314
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|189439754|ref|YP_001954835.1|
Domain Number - Region: 241-260,305-341
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0994
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189439754|ref|YP_001954835.1|
Sequence length 388
Comment S-layer protein [Bifidobacterium longum DJO10A]
Sequence
MKHLSHRTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTNSTSQGSDGDSAPIAG
PVPNIIVTNFTYGGDSVAAGADFNLDFTFQNMGQVAVTNMVITVDGGESFAIAGGTNTFY
VDALWGGYAMTQSVPMQALASAKSGAQPVTVNFRYEYVDASARSSSQSDVKISVPISQPD
RFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEGEGFDATMKTQYVGNVASG
ATGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLAIPVTDMQPVDDSDMADPNMD
QSANQGLPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKKNDIDEDWDDWSEGKDDKTDT
GVTDGAAADTAPITPVTPASPAGPSHKA
Download sequence
Identical sequences B3DT68
205913.BLD_0891 WP_010081104.1.22978 WP_010081104.1.89707 gi|189439754|ref|YP_001954835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]