SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|192288629|ref|YP_001989234.1| from Rhodopseudomonas palustris TIE-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|192288629|ref|YP_001989234.1|
Domain Number 1 Region: 27-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-73
Family Atu2684-like 0.0000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|192288629|ref|YP_001989234.1|
Sequence length 251
Comment hypothetical protein Rpal_0198 [Rhodopseudomonas palustris TIE-1]
Sequence
MNGVGGFSRWSGALGLCVTIATADLAAAEPRAVVELFTSQGCSSCPPADRIIGELARDPS
VIALSLPIDYWDYLGWKDTLADSRFTARQKAYSQVRGDRDVFTPQVVVNGSAHLVGSNRA
GIDSAIKTTDKTGGVMTVPVSVAVEGKEIKVSVAAAPQGETAKSGEVWICAVSKAIPIEI
GRGENRGRHVTYHNVVRNLLKVGDWTGAAEHWTVPLENVVGDGVDAAAVYVQNGSREKPG
AMLGAAFTSLN
Download sequence
Identical sequences B3Q770
395960.Rpal_0198 gi|192288629|ref|YP_001989234.1| WP_012493976.1.13849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]