SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|195952717|ref|YP_002121007.1| from Hydrogenobaculum sp. Y04AAS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195952717|ref|YP_002121007.1|
Domain Number 1 Region: 126-548
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.84e-103
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000172
Further Details:      
 
Domain Number 2 Region: 6-123
Classification Level Classification E-value
Superfamily Cytochrome c 2.12e-18
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|195952717|ref|YP_002121007.1|
Sequence length 548
Comment Hydroxylamine reductase [Hydrogenobaculum sp. Y04AAS1]
Sequence
MVKKFLLLGTVFGAFMFVGKEAVSQDSVPNSAKQDTQPLTKQEYEMAKQIYFNRCAGCHG
ELRTGAIGPALTPDKMKQLGIQNIETFITYGSPKGMPDWGKSGVLTPEQISVMARFLQLP
PPSPPEFDLPDIEKTWQLIVPVNQRPKTPLTNKDISNYMGVVLRSANEAAIIDDATKKPV
AILKTGHALHILRADASGEYFYSIGRDGKVSLIDLYYKHPKIVAQIKACYDARSVEVSLY
HGKEGDYRDKYAIVGCYWPPQFVILDGSTLKPLKVVSTVGYQVGTGKFIRDPRVAAIVAS
YFHPEWIVNVKETGQIWIVNYKDLKNLKITMVDAAPFLHDGGWNSTKRYFLAAANASNKI
AVLDAKKDKLAKLIDTPKLPHPGRGANIYNPKYGPLYCSSFIGQGVVACIGTDPKHHPQY
AWKVVKIIKLPGEGGGSLFIKTNPHVHYMFVDRTLNPDQKLQRQFYAIDTRTLKVVHTFN
MPKDLKGRFVDFDFNKQGTELWVSDWDKEGAILIYNPNTFKLEDVIKGKWVISPTGKFNV
YNTVHDIY
Download sequence
Identical sequences B4U7B8
WP_012513385.1.45798 gi|195952717|ref|YP_002121007.1| 380749.HY04AAS1_0339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]