SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|195953084|ref|YP_002121374.1| from Hydrogenobaculum sp. Y04AAS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|195953084|ref|YP_002121374.1|
Domain Number 1 Region: 112-359
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.66e-25
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.015
Further Details:      
 
Domain Number 2 Region: 452-742
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000000124
Family Arylsulfatase 0.064
Further Details:      
 
Weak hits

Sequence:  gi|195953084|ref|YP_002121374.1|
Domain Number - Region: 35-143
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000615
Family Galactose oxidase, central domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|195953084|ref|YP_002121374.1|
Sequence length 873
Comment phosphoesterase [Hydrogenobaculum sp. Y04AAS1]
Sequence
MKKFLLAMSLFAGVGFAKDVGNHLTPWGWDIKPVGKYVYTYNFPTNVVVSKNHIFVLTNG
ATSYQTITMYNKNLQELFQVKAWKDEVNPSKDPRYLFLPYQSFYQGMYYKDHKLYVAGGF
SDNVLVFDVYPKSLKLEKKIYLHYKRFPKNQYPYIYQGFRYDLRHFYPDAVVKGDKYIYA
TGLLSNAIARIDENDKIKYLNVGAYPYDIALSPKYIFVSLWGDNAIAVIDRNTFQFIKKI
YVGKKLGKSSESAGVHPTNLYYKNDKLYVSLANIGKIAIIDTKNLKFLGFLKDKLFKDQE
PGSYPNALFEEDNKLFVSSAGTNSINIFDIKSKKLIGAIPTGWYPSAMKVGDNNIYVVSA
KGLGSFPNTKYQWIGILMPGILQKISLEDIDKNIKNYTKELFTYDKFDDIKKQDKLVKFL
RKHIKYVVFILRENKTFDEDFGTYKRAGKWADPNLALYTKKELPNLFNFADHYVLMANFY
ADGEVTAQGHQWTTGASVSDFVERTWQEYYSGRGLAENPGWTQALTFGYATGWGGMPNGV
DNPFAIYENLDKLGEWSNPWISYPYKLYLFNNLLAHHVSFEDFGEFVSRNRWGDIPKAMK
PHIGYSFPGWNRFILDTFRADAAIKWFKTHKMPKFSYIWLPDDHTAGLHPCYYTPQYYVA
NNDYATAKIIEYLSHTPYWKHMAIFITEDDAQSGADHIDAHRTFAVVLSPWVKSGYISTK
HYSQINIVKTIEKVLGIPPMSIFDQTTPVISGIWTDKPNFSPIKAVKPDVKVAFNPGYCN
NYTLLRREAGATGHYVNKKWLEKHMKKDSKDSSYIPSSKNLYTPTSLLKVSGFEQFKQSA
IATKGYSGYKKMLGYIKTLAKEQNKSVWAFISN
Download sequence
Identical sequences B4U8D5
WP_012513752.1.45798 gi|195953084|ref|YP_002121374.1| 380749.HY04AAS1_0709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]