SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379720049|ref|YP_005312180.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379720049|ref|YP_005312180.1|
Domain Number 1 Region: 538-636
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000225
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 645-757
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000167
Family Cellulose-binding domain family III 0.018
Further Details:      
 
Domain Number 3 Region: 231-376,419-469
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000165
Family DPP6 N-terminal domain-like 0.038
Further Details:      
 
Domain Number 4 Region: 776-828
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000123
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379720049|ref|YP_005312180.1|
Sequence length 832
Comment carbohydrate-binding family protein [Paenibacillus mucilaginosus 3016]
Sequence
MLMIKKGLAGLLFGLFMILLLPSYVLAAGEVTVKINSIQVYEDTVYVKATISSASKVTQV
KASVDHLVFPLYGSCWDQCQWEGYYENLWELTQGTKTLTVSAINELKQTGKAAQTFAYDK
PPMLVLQKPQDGVITAGYLRVKGYAFDFIGPSEIRASVAGKEFAVDDTMVVNNMIQLDHM
IDLTTAPEGLHQLHVQAKDTAGHVSEDTRQVLLVKKNLQVTDHVYGDILDFDSGRILYLG
YDEKLWLRDRSTGSETELYQGSNFSMTTLTSKGAAFIPYREDGQDIKLHLFVNGQTQEIP
VSQLHGFALHGYGGDAALLSERYDDMTYVNLNTGEKIKTSWNPVYDGDFSRVFMTKDGRA
IILNYNRLYEYDPASGYKLLAELNGEPRGLVSDGNTHLFEMYEWMGGDKYTTYIYKDGSL
TVLNTQNRYNLSPFAVKGGWVAYVKLVAGVEQIFLRSPDGVEKQVTDAFDHAALEALAED
GSLMYRTMGISHYLPVGGESAVEMGTSFGVHRYVDNRLYKITEGTLAEVLIDSQPDQTAP
YWPSPEPLTVSSVTYDRAELSWQSAMDDVGVSAYEIYKDGQKINTVSADVYAYVIQNLTP
ETTYEFEVKAVDGNGNVSTDNPKITVTTLPEQPPAATGLKLQVKPGYLDTGSTVELQVRA
EQATDLYAFLTKLQFDPTRFKLMQAQLSTDFGIEKSTAVLATSKGASGVVNWSGSLLGQV
NGRTGSTGLLTLKFTVLQKGAGEFVLLEGSQTADSQGNISRLDEPTRISVYVGGADLDGD
GSVTLSDLVLISLHSGTSEGQSGYDALYDLNNDHVINASDVQIVANKVAAAA
Download sequence
Identical sequences H6NF24
gi|379720049|ref|YP_005312180.1| WP_014369451.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]