SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379724577|ref|YP_005316708.1| from Paenibacillus mucilaginosus 3016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379724577|ref|YP_005316708.1|
Domain Number 1 Region: 547-645
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000957
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 2 Region: 1076-1145
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000944
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 233-412
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000000000981
Family Tricorn protease N-terminal domain 0.025
Further Details:      
 
Domain Number 4 Region: 754-940
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000000745
Family Tricorn protease N-terminal domain 0.019
Further Details:      
 
Domain Number 5 Region: 1305-1352
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000275
Family Type I dockerin domain 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|379724577|ref|YP_005316708.1|
Domain Number - Region: 1179-1291
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0649
Family Cellulose-binding domain family III 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379724577|ref|YP_005316708.1|
Sequence length 1370
Comment hypothetical protein PM3016_6968 [Paenibacillus mucilaginosus 3016]
Sequence
MIRSRKGPVYGLILMLLFPAQIHAAGAMTVSIVAPGQGMPSGTVLQVKAAVSGSTDVKGV
TARVGEREAPLTKTCIYAQCHWTGPLSLEGLPKGAKELSVRAEDTGGRSAEARQSFVYDE
PPQLKVTGPSSGYVTRDGLFLVTAEASDDTGQPALTVKVTEYQSGLVLGSFQGGTKVSQE
FDARAFDGRKLEIHVSADDGKGNVVKETRIVHVEMSPYLSEVEQVPGEIADFDDSRILYT
AGDGSLRIRQRGGTEDTMVFAEPGRTTLEQKLVPGGAVFSLYRAGSFSDQELYLWQGGKL
TPLASGASVRSAAWRAVSGKHAVYDEFPLSQTYYLDTETGERQVIGSSIYHADITPEGHL
VFFDTDGIYRFAPDTGTRTLLLGLDGWESYEYSNPVADGDRLLFSYHSNISKFDGGAVTE
LSPPYTDEEIERGAEVVPYRDYQANQGWIAYTKGDETGRAIYLESPDGEVREAANVGGHP
ALGRLTEKGTFSFYYNGRLYLAGPQTEPVAVASSRGKDAYRGGAFYKALGDTLFRISTKL
DKLPPVWPEEAALTVTDVTYDHVRLQWQGAEDDSGEPLTYSIYRDGELLTAAADPAAGYV
AEGLEPGRTYSFSVEARDGAGNRSLDNPQVTVTTSQRPFVTEPPKVELVAPLFEEVVRSG
GLQVKGAVSDDRGQPAVSIRLHIEGLKPVEIPAAGGAQVDQTLDLSAYEGQRVEVEVTAV
DDEGQTVSVRRPVHVESGRALVMEAEAEGRIVGFDQERLLFIRSDGTLVLRSRAGGEDIP
VFADPEAVTDEHTLTPDGVLFSAYASGSGEPKGLYLWRQGKLTELTAGVRAAEGWWLLRQ
REHAVFAAVEENRNAYYHLNTRTGAVTPIAVNGLSGADADASGGLILSDGTGLYTFRADS
RALEPLLLPPDGKRYEQPEWEGGRLLYTSGGAIVQYDGTSSTVLSPAGAEGERLDGAVDY
EAAGGWTAFTRSMGDAAGSRQIFLRSPDGTVTQATSYEDHGHPRISGLAADGTLTFYSDR
NELYVLSPEGAAQRLASADGVDGLRDGTFYKAVGRTLFRLETGSGGTRPPVWPAGEALTV
SGVTYDSALLQWQAAAAPGGVQAYTIYRDGEPLGTVGAAVYTYKATGLAAGRTYTFSIAA
TDRSGLVSADNPSVKVSTPGAPVPAGGTVTLQAKPGFLHAGSELELRLRARDAADLRGFL
LKLDYDRSRFKLNHIFLHPEFGTENKTVQLSKYLSTPGRIGLKGTLLEPKPPISGSPGLI
TLRFTVLQPGEGTFTLAGGSVFTDSRGAMHPVPTPVTLTVYADSADLNGDGRTDKEDTAL
ISSHLGTSAGQAGYDSRLDLNHDGRIDAKDLQHAEALAAAGEAGSKPASS
Download sequence
Identical sequences H6NRC4
WP_014372517.1.63014 gi|379724577|ref|YP_005316708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]