SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312137288|ref|YP_004004625.1| from Methanothermus fervidus DSM 2088

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312137288|ref|YP_004004625.1|
Domain Number 1 Region: 39-167
Classification Level Classification E-value
Superfamily Sortase 6.41e-25
Family Sortase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312137288|ref|YP_004004625.1|
Sequence length 241
Comment sortase family protein [Methanothermus fervidus DSM 2088]
Sequence
MCTGGGNVKVKLSTVMIIVGVFIIFLYALIEVSYYASKITIENKYTATLEIPAINLKEEI
NNKSLSYGVYYDPRSSIPGSGTTVLFGHRTLYGSPFMNLDKLKKGDVVYVNWPKVGKIEY
KVDKSFVVPADYEIPLRQGNKLLLVTCYPFGSTSKRLIVECKIVKILPLEKIKVENPNKN
YSLAIIVLFFLFCMLIYKIYPYREDKLILLVVFLSLTLILIFAYINPVPPEFISDKLLSW
S
Download sequence
Identical sequences E3GW98
gi|312137288|ref|YP_004004625.1| WP_013414141.1.12012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]