SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312136957|ref|YP_004004294.1| from Methanothermus fervidus DSM 2088

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312136957|ref|YP_004004294.1|
Domain Number 1 Region: 2-251
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.1e-129
Family Methyl-coenzyme M reductase gamma chain 0.0000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312136957|ref|YP_004004294.1|
Sequence length 267
Comment methyl-coenzyme m reductase subunit gamma [Methanothermus fervidus DSM 2088]
Sequence
MAYEPQFNPGETKIAENRRKHMNPNYELKKLREIADEDIVRVLGHRSPGESFKTVHPPLE
EMDFEEDPMKDIVEPIEGAKQGTRIRYIQFADSMYNAPAQPYDRARTYMWRFRGVDTGTL
SGRQVIEMRELDLEKVSKILLETEIFDPARCGIRGATVHGHSLRFDENGLMFDALQRYIY
DEDSGHVVYVKDQVGRPLDQPVDMGEPLPEDELKEITTIYRKDNIGMREDEELLEVVNKI
HEARTIGGFGMEVFKKDLNKRLGGANE
Download sequence
Identical sequences Q49173
gi|312136957|ref|YP_004004294.1| WP_013413810.1.12012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]