SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313683256|ref|YP_004060994.1| from Sulfuricurvum kujiense DSM 16994

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313683256|ref|YP_004060994.1|
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily CAC2185-like 2.48e-50
Family CAC2185-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313683256|ref|YP_004060994.1|
Sequence length 208
Comment hypothetical protein Sulku_2134 [Sulfuricurvum kujiense DSM 16994]
Sequence
MKKFINKQRLKIKHFWHQRFLKHHDFTIISNNCWGTRTYQKFGIPYSSPFQSLFIFAPDF
LNLITDFSVDKLTIEKFISYEDSKYKTELEKENLDKEDYPIGILKDGTELHFLHYKTAED
ALDKWNRRVKRMNDKMIFKFSDGYASDDALIERFDALPYKHKICFTAKAYPHLKSVVYMD
RFRQNGKVELEWKYDRKYINLHSFINAL
Download sequence
Identical sequences E4U397
WP_013460991.1.75161 gi|313683256|ref|YP_004060994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]