SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32473001|ref|NP_865995.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32473001|ref|NP_865995.1|
Domain Number 1 Region: 607-839
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.18e-42
Family DNA/RNA non-specific endonuclease 0.0024
Further Details:      
 
Domain Number 2 Region: 245-417
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.73e-33
Family Prokaryotic proteases 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32473001|ref|NP_865995.1|
Sequence length 867
Comment proteinase [Rhodopirellula baltica SH 1]
Sequence
MDHRVVAAKQEPVPPRNAESFKVTVEWEEPAKSNVAGFYAVAGLYATSRTRTQVSNRDQF
QLMNRWDDSTVSSEWQRAKVRHDSRPEWESRGTIQYSFPLYSCWLPYQSSVVIGLMIGEN
LIQAIDTMEPVVTQNYEHSVIPDDVIAATEKRFHNIQQEFDSPLEKSRSDLLAQNGLSTI
QDRLERAGVDPKLAKQASRAGAANRSLDSASMSRATISEASALERILNGNDLVDVRFLLN
GASRIASVGRINFGGRGFATGFLVGPGVIMTNHHVFGSAAETRGVQVEFGFRELNRDGGL
STPTKFRFDASQLFFADRDLDVAIVAIGSRTSGSIDLDKLPVMRLLPDSDAVIMGERLNI
VQHPAGEPKQVALRDNTVIAIPDETFLHYRADTKRGSSGSPVFNDEWQLVGLHHSGVPDK
DDDGNWLDIFGNVATNRTPDHHIAWIANEAIQSSALVELLKDTTFRGSEQRLVDGVLEES
DSEESIVQFRSPNCHNEPHCEDGNLPQRPVADGVVRVAQGRGTVRVRVPVEITVRIGEPD
DHILVNNDFDVVSVERLRERFGIDRDYSNRNGYDAEFLAHKLNLPALTEDQIAAAAINRD
PINGDLPYVLRFHNFSVVMNGERRLAYFTAVNIDGEKLIRIRSGDDGGSASWSEDRRIGA
HEQTNNDHYRGRDNKLDRGHLVRRLDPGWGGQLRDSARGIVDTYHYVNCAPQYDTFNQSD
DRGDDANGLWLGLENFALDNAEKHDVKISVFTGPVFRDSDPDFRDNGVRIPTQYWKVIAW
VDESNDLKAAAFLLSQKRMLDDDPRIERMDEEAFDFRERDLFQTTVTKIEELTHLNFGPL
NDARGGGESTATQVPRLLRSYKEIVLT
Download sequence
Identical sequences Q7USW1
gi|32473001|ref|NP_865995.1| 243090.RB4270 NP_865995.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]