SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|511629191|ref|YP_006189997.2| from Paenibacillus mucilaginosus K02

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511629191|ref|YP_006189997.2|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Resolvase-like 1.57e-37
Family gamma,delta resolvase, catalytic domain 0.00039
Further Details:      
 
Domain Number 2 Region: 370-455
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000549
Family Occludin/ELL domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|511629191|ref|YP_006189997.2|
Sequence length 473
Comment resolvase [Paenibacillus mucilaginosus K02]
Sequence
MRACIYTRVSTAGQAEEGFSMQAQYDKLIDFVKLQGWDLIRVYTDPGVSAKDLNRPGVKE
LIDDLKVGKFEAVIVHKLDRLTRNISDLYDLVELVNKYEVKLISLSENIDTSTPMGRMFV
YLLGIFAQMFRENLSEEIKKGLSKRADLGFRNAGAPFGYKMDERGNLIIIPEEAELVRVI
FSLHISKKWGFYTIAKYLNKLGFLGRRGGIFHGSSIEKILKNHTYVGKNHWKLKGRPESE
RMVRDANHEPIIDQDTFNKSQEIIRRRSQKEMSRSFYSYPFSSIIRCGQCGAPYHGIMQP
YKGIKYYYYRCFNVIKGRCNQSSISELKFETMFFDYFIVQHQGVNFEEVAATKSDTSEVK
RKIERELEKSEQRRKNWQYAFGDGTIPYKDYVALIDEEMRKVEELQLQLSDLPVDESPVK
ITIKEVIETVAQLKDNWAYLERETRKDLINSLFKSITITKFDYGWVITDVDWV
Download sequence
Identical sequences I0BIN5
gi|511629191|ref|YP_006189997.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]