SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32477673|ref|NP_870667.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32477673|ref|NP_870667.1|
Domain Number 1 Region: 293-383
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000315
Family C-type lectin domain 0.0041
Further Details:      
 
Domain Number 2 Region: 556-666
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000994
Family Collagen-binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 1739-1800
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000235
Family Type I dockerin domain 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|32477673|ref|NP_870667.1|
Domain Number - Region: 955-1035
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0432
Family Collagen-binding domain 0.009
Further Details:      
 
Domain Number - Region: 1347-1424
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0824
Family Collagen-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32477673|ref|NP_870667.1|
Sequence length 1901
Comment mannan-binding protein MBP (lectin) [Rhodopirellula baltica SH 1]
Sequence
MADTGSTSPSQQVTQDEGRALIPGRAQRNRRGRSTHRRNAAANRRRARLEQLESRWMLAA
DAISDMPESTPLVFAPVVEGRDLQIARSTGDLRQTSNRFSLSTEEQTELSLYVNSGGLAL
TFSATLFDEDGNYVTSSDPYAQHDHKSILVPEAGEYLLEVDPSFSSDYASDYQLRVLQGS
LPFETESLAPLLSNLQGIGTASVAGVIASGLHDEDIDSYSLGFLAEGTRVDLTASIPSGG
TAAPIIELRGSRGIVVDQNPARGKVEAVVPSAGTYEVRVRQETVFGDSQYKSRGRNTKIE
AEQLAHESGGHLLAINSAEEQSLFEPIESETWIGISLGEHESVDSLRWSSGEEITYNNWR
EGEPALHSHESRGDGVMDQSGKWALKQVFSYISKTTIIELPRNEDDPVSSFAGPDALYLL
DVVVTDADAPQVVSVSGIPTHDIVADSPLIELGFEFSEPIQATGDLNHIVDLREAGVDRE
FFTDDDRLFQTTSKLDSPTELVVCIMDGPIADGHYQISISDQLTDLFGNPLAAGAGYSKS
FEIAIDTKRFIFEGVDNDTMETATPIPLTPDLGGTGLSHTTRTGLGLISQYGDPDYWTFD
VAAASEIAVRITGSGRGLTLLDADENVLAQGNNVINAVSLPKAGQYFVLLSGSLGSDANA
PYQLSLDVSQSITLETNSRQSNINPTTEDIEFNETTNPRLATVAGALSVGSDSPQDRFSL
GTLNAGSTVSLRSILPYWSTLKPFVELYRGYERVLDTNVSEEVFEGTSATDGMYYAVVRA
DIGYGLHGQYILDIEIDDDIAPKLLGTPGLPAADEAGTELIGRFALNFSEEVLLENDSID
LREAGDDGQFDTDDDRSFYVELTGDETNSYFEFIVSDGPLDTGQFRLKLDADITDLSGNT
LDGDNAVTQFFQLNAVDNTEIFEGFDNGQRDRATVLPLELDPTGTGFSRTPRSGVGLIET
FNDTDWWSFEAEASQTIRVTLTTKMIESLDLTVTDSEGHTIAGTLAMHQQVDKSTLVNRF
QVPSDGEYYIQIQKRHLIYSEHQRDYELRIDTVAGQALESREQANQHKGHGDTIVLNSTP
DGSLKGSIAGTLLLADRDTYKLGSLEPNLQVRFTIDRPEWSQVEPVIGLYGVGSAFTEIS
PDEDGSFRALTTDRGEYEVLVAANPKGNGAGFDGQYVLNVEAIDPVPFQVTEIRGLPSDN
SETDQMLSDFEVTFNRNLSEGSFETSKASIVEAGADGQFGTSDDQSYALKHEFAFAHGKT
QYDRLHFSVDSGVNVLREGKYRLHLPASFQSRYGEPLEEGDGYSTDFSIGELPDGYLVEG
PTNDDRTGAVHLDPEAPGSNWLVRGIGSLERDDDIDHWSIDASAGDWVTVWTPNRSSSYF
ATSGLSNEAGQYMTASSRHHQYPQQGAFQHYVIPTDGTYFVAVEGNTAQLPNDRLYELWV
HIAPLADGGTPVEGYHRDHPIFQTTDRGETAVVADSFISDESGSFYPYHETTYDIGHLPE
HTDIRIDTRSTTWTFANPFLLLDPIANRKSQRFVVTGTITDQLGTELTIGPSNLYPGHVP
NSQQRADYIVEIQSFDVTAPKISLDIETDSDTHYVRASASDSDELGRQGSGVAQLSLFSI
HDGLLSHRQAGTTNRIEHTITSAHASHFFATATDRVGNRSILDLSDQDLGPISIDSAIAD
NSLVTWPSQIIVGSGTSLTWSGQWDVLLPIVRDNRLYHRVTAGDQVIELEAVSEDQNPVL
AHDVDRSGSVSAIDALLVINHLNSEQAQTGTWLSLGGLYFDVNGDSRFSPLDALQIINQL
RFGPTSGESEFIPIEQTAPQTFICRFAPSDDSHETIHSVNDPAIQAQATNQFIDATPAVP
ASQSLSELGTSTRDEPRMPLDPTTVDEVLTSSISSDLKHLV
Download sequence
Identical sequences Q7UI70
gi|32477673|ref|NP_870667.1| 243090.RB12720 NP_870667.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]