SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317050137|ref|YP_004117785.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317050137|ref|YP_004117785.1|
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily HAD-like 9.8e-42
Family YihX-like 0.0000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317050137|ref|YP_004117785.1|
Sequence length 198
Comment HAD superfamily hydrolase [Pantoea sp. At-9b]
Sequence
MLYIFDLGNVIVDIDFNRVLGVWSDLGRVPLATLQSRFRMDEAFEQHERGEISDPEFAAR
MCEQLDVALSYEQFTAGWHAVFINPRPDTLKLMNQLRAEGHRVVILSNTNQLHYEFWPSQ
FPEVQQAADKLYMSQDIGMRKPEARIYQYVLDNEGFTADQTVFFDDNHANIEAARALGIE
SVLVTDSKTVPAWFASHR
Download sequence
Identical sequences E6WBV9
WP_013511062.1.99583 gi|317050137|ref|YP_004117785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]