SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479177886|ref|YP_007805487.1| from [Ruminococcus] obeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479177886|ref|YP_007805487.1|
Domain Number 1 Region: 37-154
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000196
Family Collagen-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|479177886|ref|YP_007805487.1|
Domain Number - Region: 163-202
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00929
Family Collagen-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479177886|ref|YP_007805487.1|
Sequence length 205
Comment hypothetical protein [Ruminococcus obeum A2-162]
Sequence
MLGERVKKLTKLMLTGLTMALCVVAFSPTVKAEAAMLQESEPNDNPAQANQLPLNTWVKG
KMDDEYDYDVDWYQFTIPKRGVSQIEMIPDSTNTSGAGWEVSVQDVNRHEMLQISGRTAE
SYKLGLAPGKYYMKVSGIHQTFVDNTHPYNLRINYSESEEWEIEQYYENKNFSNANNILP
NKKYTGNMYSERDVDYYRVKINGKQ
Download sequence
Identical sequences D4LRU7
gi|479177886|ref|YP_007805487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]