SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386038781|ref|YP_005957735.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386038781|ref|YP_005957735.1|
Domain Number 1 Region: 600-755
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-38
Family Histidine kinase 0.0043
Further Details:      
 
Domain Number 2 Region: 405-528
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-24
Family Heme-binding PAS domain 0.026
Further Details:      
 
Domain Number 3 Region: 537-606
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000216
Family Homodimeric domain of signal transducing histidine kinase 0.0038
Further Details:      
 
Domain Number 4 Region: 353-398
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000157
Family HAMP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386038781|ref|YP_005957735.1|
Sequence length 758
Comment sensor histidine kinase [Paenibacillus polymyxa M1]
Sequence
MSIKIRITIILSGSVLFILLLNIALNYYTTHENLRSDSETKMVLTAKIIGGAIEQTRHSW
EAVDKQLGYNLWLSATLAANQLDPDIRNIQQEQLQQIATLHRDINISLMIRDGQGYKVVK
SSNPKELTSSDPLMGYWKNAVDQLYEHGQVAMAHGQNLDHFWTSSFDYTDSASSHINKWG
FYYDQKRNYLIRVSFQDTSVQDFIPILSPAEIVKQTQQVDYRILEITGINPATFGGATMD
KNGNDRKHYYMYNEPIQFGTYQLARVPEDRLAVSRAILSGESIVQDCYIKGERVLVSYIP
FYPTNRDAYVIRIVMNYDTIASVISKQLISLVAISIVLLEVVIIGSYVLASLFVRPIQSI
LGKVNEMADGHFDTRLEIKGGHELARLGERINAMAYNLGMYTRRLEQMYEENRSVKEHLE
SVINQTADAIHVTDQEDRVIRVNHAFEALYGWTKKELVGRKLEFVPPQQQEEYEFQKESL
LQGESIVSSETLRMRKDGSTVEISMSTSPILDEQGEILGFICVSRDITGRNRMEELLRRS
EKLTTVGQLAAGVAHEIRNPLTTLRGFLQLQQQNQVLNMKHNDIMMSELDRINLIVSEFL
ILAKPQAVHFQKKDVRYIVSDVISLLDSQAHLLGIVFNLQVTDEPALVYAEENQLKQVFI
NLLKNSMEAMSKGGIITIHLFLEGESVKIFIRDQGTGIPAEMLSKLGEPFVTNKETGTGL
GLMVSQRIIQSHKGTLDIESTEGEGTTALVQLPIAKPE
Download sequence
Identical sequences WP_014599353.1.6267 WP_014599353.1.91857 gi|386038781|ref|YP_005957735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]