SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386038959|ref|YP_005957913.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386038959|ref|YP_005957913.1|
Domain Number 1 Region: 450-595
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000249
Family Histidine kinase 0.083
Further Details:      
 
Domain Number 2 Region: 329-380
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000017
Family HAMP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386038959|ref|YP_005957913.1|
Sequence length 604
Comment two-component sensor histidine kinase-like protein [Paenibacillus polymyxa M1]
Sequence
MKRYIHKIKYQGLFFKIFIVMVISITAVSLLTSLVTIRMSERLFAETFSITNAKVLSQIQ
SSFESFNDSIVNAVTHASENGTVKNYLTGGQSDSINSARIYFGMAQQMKQIKSNVDAYDV
GVAVTGMNGRSFYSDSSYWPVTAEQLKSSSITARSVARPAQLMYQMDTELFHQQMNSTAQ
KPTPYIIASKVFMERTSGTMYGMIYIAIREPEFRRFYNNFTSNGNDVLIMDKSGLIVSSN
RQDLIGQRSSELLGYATKINEQGLNYINADVMNKESIVLSNYIPSFDFYLVNMIDRQTAV
GQIIDVKSVVWICIAIVLIALVIVFLISRRLIRSLTRLVKQMSTIREKNFDNYIPVTGSY
EVRQLSHAYNYMLDELNDYIRKLLETQKGQRNAELAALQRQINPHFLYNTLASIKMLVLK
GNKETAAETINALISLLQNTISNVSETITIEQEMANMQNYVFINHVRYGQRVQVNYFVSP
DCLEYHVPKLIIQPFIENSFFHAFNEKNAGHIYILVSKTDDTLICEVVDDGDGMDLDGHT
VQDGLPNPKSKRQLFTGIGIQNVHNRITLLYGEEYGVTISSKKGEGTKVRMTLPLILKPV
PPTP
Download sequence
Identical sequences E3ECD2
gi|310639758|ref|YP_003944516.1| gi|386038959|ref|YP_005957913.1| WP_013368917.1.14980 WP_013368917.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]