SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039069|ref|YP_005958023.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039069|ref|YP_005958023.1|
Domain Number 1 Region: 433-586
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.89e-19
Family Histidine kinase 0.03
Further Details:      
 
Domain Number 2 Region: 313-364
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000144
Family HAMP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039069|ref|YP_005958023.1|
Sequence length 598
Comment histidine kinase,histidine kinase, HAMP region [Paenibacillus polymyxa M1]
Sequence
MMRRFQSIQYRLFVLFLLSMSSIVLAVSLLFYNRTTVQFHDKISELARKNVSQTAGLFEL
LLDSYNSLSKSISNNMDLVRLLTTDHSDLPAVNYINERTITNILGAIYYSREDLIGIHVI
TDTGKVYNYGNYMNVIDTHYEHTEWYREIRRSAGKIAWLGVYPHSVIDQVETRPVFAFGR
QLYDLDEHKPIGIVLFEAEPRSVLSALHNLRLSTNSQVYLLGHENRIVSATSSDPPPDLR
NLQEQVPEEDVIVDRNNEKVVIASKLPFADWSVISVTPSEDLNVELAQNQRYLFIVAPIL
IMVSALIASIVSRSISHPLKRVIGEMKRVETGNFRHTVNIESYEEINQLATSFNHMVRQI
AELIELVRISSVSEKNAELHALQTQVNPHFLYNTLDMIYWMLDEKGQDQLGEVVLSLSHM
FRYSSHWEEGADVSLREEVEQVGHYLTIIQARLEGRVSVDVNIEEQWLDIRLPKMTLQPL
IENAVKHGLEPLHADTGGKLLVRAEEYGGVLSLHIIDNGVGMEYERWEVVQVALAEPGKQ
AGSGQAGGIGLQNLNLRLRHMFGEEYGLRISSTPGAGTTVTVSVPLPQKEEKHEYSDS
Download sequence
Identical sequences E3ECU6
gi|310639873|ref|YP_003944631.1| WP_013369030.1.14980 WP_013369030.1.6267 WP_013369030.1.91857 WP_013369030.1.99789 gi|386039069|ref|YP_005958023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]