SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039204|ref|YP_005958158.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039204|ref|YP_005958158.1|
Domain Number 1 Region: 377-554
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.39e-41
Family HD domain 0.02
Further Details:      
 
Domain Number 2 Region: 317-365
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000068
Family HAMP domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386039204|ref|YP_005958158.1|
Sequence length 564
Comment response regulator rpfG [Paenibacillus polymyxa M1]
Sequence
MPAADFARPRCPAKAAIRCGPLASVIFLRSMQIAQARRLTFDGWTPILNTKISYERTDEK
RGSILPIYKRFIQHVILNYIIGSFIAVLLVCMIFVFSTLNVAHYELLGLVKIVAFSSVIM
IVCETIVFRMHLRPVHRFFQGNQETLKDVEAVYIRVHHLPNLSVLRIVGPHLLGFSIPAA
VIALWMIHTGQLTFPFYYVGIACIGACLVASMHALVEFFLTMRAIKPLLEEIRDRTYQQY
GLSLSLRGRVLLSLRHKFQLSATLIGAFPLFLFCLATQIRLERLEATDSGSYWAWAGTIL
IFGVAFAYLGGRLLTREIEQPIHHLLEKMNEVKEGRLNSNASDLYSDEFAELVEGFNMMI
EGLKEREEKNGQLLDSYFATLAAALDARDAYTAGHSLRVAEYSVLIGRKGGLSETDLDLL
RKTALLHDIGKIGVADAVLFKDGKLTDEEFDQIKMHPVMGESILRQVEPAYAMAPYLPGV
RSHHERYDGKGYPDQLSGEDIPLFGRIIAVADAYDAMTSDRPYRKGMKEEKAVMILEEGK
GTQWDPYFAELFVKEWRRNKGILS
Download sequence
Identical sequences gi|386039204|ref|YP_005958158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]