SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039216|ref|YP_005958170.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039216|ref|YP_005958170.1|
Domain Number 1 Region: 437-591
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000397
Family Histidine kinase 0.015
Further Details:      
 
Domain Number 2 Region: 321-369
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000103
Family HAMP domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039216|ref|YP_005958170.1|
Sequence length 604
Comment two-component sensor kinase [Paenibacillus polymyxa M1]
Sequence
MKFHSIRSRLIWFLLIAVTLPLLLSMTMTFILTKQSLREQATQENERLIFQGITNLDNYL
QGLNRASIGVYNDPHFLRNLAKIPDDYRAVAEIYTTLQTMMNASSGIDQVYLHSFEAGQS
TLITSTVPLREFRLEPFTGSIHYGPSGLFMQPSHIKHLYGFSAVSYAEQNTKRQVFTLHR
AIRNIPSSETLGVLAIDVDLEPLRSICRQLYDADTEELFLIDRNGTIVYSGKESFIGTHW
KESGLLKRISKEDEHGVIEDDTALHVYGKLDANLSGWTLVKKIPHRTLYLRATQLTQINA
VITGAALLLVIVATLWISIKITEPIKRLTRYINQIQSGQLDVDIRAMSNDEIGVLSRRFR
QMMDTINNLILREYKLELANKTHQLKALQAQINPHFLYNTLQSIGTLALQHEVPRIYSLL
SSLAKMLRYNMRDHTVVTLKEEAEHVKQYLDLQKERFGEQLEVTYQWDDEVLNDRVPKMI
LQPLVENYFKHGADPRLGPGKIHITACRIREGIVRIEVENNGASIPPTELEQLQQMLKRP
LKAHEESDTSEQNSIGLRNVLLRIQLHSEDGSNTLCVDNILPHGVRFTLEIRTEPHTENH
IKGE
Download sequence
Identical sequences E3EF25
WP_013369184.1.14980 WP_013369184.1.91857 gi|386039216|ref|YP_005958170.1| gi|310640028|ref|YP_003944786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]