SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039336|ref|YP_005958290.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039336|ref|YP_005958290.1|
Domain Number 1 Region: 425-587
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-35
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 355-436
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.35e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0007
Further Details:      
 
Domain Number 3 Region: 296-344
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000549
Family HAMP domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039336|ref|YP_005958290.1|
Sequence length 589
Comment sensor histidine kinase [Paenibacillus polymyxa M1]
Sequence
MNKRGVTFKLFIMTVVFFLCFYGMVILSQLLFFENFYQKQKIGRVESRLQSFGQSYVQEA
WGSGRVSREAARFMLQNKNQLAIVTLDGKVKLDDAFHISLRKADGKVVKISLSLFMSEHG
DELRAARIQPGDQVTVEGEMLGSDGISSANLIYPTGIQKLGFNNIGLNSEETSTNDSVRL
SGTVTEIVLPDLKTWSQRQGLLFSALEEWFPLSQDHLERLKNFEVLEEDWTEPWTGVRNA
VIVHPVRQSTGEIDLLFTVTSLQEISETNEALRWFYLYLGIGGFALILILSLFYSRMVTR
PLITLNNTAKRMAKLDFTAHTPIRQNDELGSLSYSMYTLSQNLDTALRELQEANQQLVED
MEQKQRMEAVQQDFFANASHELKTPLSIIKGFAEGLQDGVSAGKQDHYMKVIVEEADKME
RLVKDMLDLAKLESGTLKLRKATFILSELVEEVVDKLFHLLKEKKLEVVIIPANELPIHA
DIGWMEQVIINFVVNAIRHAEEGSSITIRIEGSGEVNTFSIENKGETIPDDQLELIWNRF
YRAELSRSRQTGGTGLGLSIVKRILDLHEFRYKAENTKDGVRFVVIFGG
Download sequence
Identical sequences E3EGP0
gi|310640162|ref|YP_003944920.1| gi|386039336|ref|YP_005958290.1| WP_013369315.1.14980 WP_013369315.1.31500 WP_013369315.1.91857 WP_013369315.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]