SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039403|ref|YP_005958357.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039403|ref|YP_005958357.1|
Domain Number 1 Region: 403-560
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.42e-41
Family Histidine kinase 0.005
Further Details:      
 
Domain Number 2 Region: 346-410
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000471
Family Homodimeric domain of signal transducing histidine kinase 0.0038
Further Details:      
 
Domain Number 3 Region: 221-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000167
Family Heme-binding PAS domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386039403|ref|YP_005958357.1|
Sequence length 579
Comment putative sporulation kinase [Paenibacillus polymyxa M1]
Sequence
MLIALKESVLQVLLAVISAGFFSILTDYGDKKKVWAGNLLPGPHQGILYLCCLPAILLCS
LFQYQPPYGLPSNLGIIPLAVGVMYGTRRTSFVLAASALTGVLIIAQSIEMSPMYVGTAF
ILFPFMLLHVKFFQRGTLLDKKLVIFTYVVADMLLKALLPLLWGKQNISVYIPDLLTTFW
NVAVGVLASFTVVSLMHNSFEKLTLRRDVTEFTSKYLIEVDKLRQVMDLMPLSLVTLDSE
ERVIHMNKTMLELYRDFDPYITLPEVVGRPLNSLYVFSASPVVNERVAKALEGEAGADFI
NVSPKVFFSSFLPIRDKHINQTTGVIIALQDITELETLRSELGNFERLSLVGQMAAGITH
EIRNPMAVVRGFLQLMREKSPDSLSHYYRIVMEELDRANGIINDFLSLAQNRIVEKEQCH
LHDIIRELTPLLWADANLRGQTIELKLEDHVTMLHLNPKEIKQLLLNLSRNAMEAMGEKG
VLTISTHEEEDFVELEVRDTGPGIPPKQLEKLFQPFYTTKTKGTGLGLALCQSIVERHHG
TIAVDSVEGMGTQFKVRLRRTIPTYREHSETPVINSIQK
Download sequence
Identical sequences E3EI83
WP_013369387.1.14980 WP_013369387.1.6267 WP_013369387.1.91857 gi|386039403|ref|YP_005958357.1| gi|310640234|ref|YP_003944992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]