SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039441|ref|YP_005958395.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039441|ref|YP_005958395.1|
Domain Number 1 Region: 446-589
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-21
Family Histidine kinase 0.022
Further Details:      
 
Domain Number 2 Region: 321-378
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000288
Family HAMP domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386039441|ref|YP_005958395.1|
Sequence length 603
Comment two-component sensor histidine kinase [Paenibacillus polymyxa M1]
Sequence
MQDERRRRHVLITYFKSAYKNAGIHHKMVLLITVLMLVNFAVVAVILKYVFHIYDNQMYK
KTSEVLNISSIGIENELKDVEKVTFKVITDEQLQRYLLQLEKETSPYVKMVLRKKITNRL
IAFAGSETYVYSMMVIDKEGQVMSAGNREGIPQELRSTLSELADEYDGSHAWYAAGHSSL
LAARQFKSFTDSNFTLNGLGTLAIRVRIDRIVADRVQTSGRDGQLMITDGRRMIYPETPL
LSESDIQAELGRKQPYGIATYTGGTFFAAQIKSSYTGWTYLHMTPFDDMFRSITIIKEIV
SAIFVIMLLIALALGARLSGSITQPIVQLIQNMRKIEKGDLDRLEEEALGAVPLSTQDEV
GLLHRTYKKMIRRIRELINENVAKQLLLRETELKALQAQINPHFLYNTLESVNWLAKANK
QDRISEMVEALAFLLRSAVSFEEQLIPLQKELDIVRSYVTIQKTRFDERLVFHLDVPEEL
MDAQIPKLTLQPLVENAIHYALEPRIEPCRITIVVRESEGALFLRVEDDGPGMTPDFLEK
LRSGQITTRGRGIGLANIQERINLTFGTPWGIELHSESGAGTSIHVCIPYVKGDQGRVQG
ATG
Download sequence
Identical sequences E3ECM4
gi|386039441|ref|YP_005958395.1| gi|310640279|ref|YP_003945037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]