SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039668|ref|YP_005958622.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039668|ref|YP_005958622.1|
Domain Number 1 Region: 320-467
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-19
Family Histidine kinase 0.011
Further Details:      
 
Domain Number 2 Region: 197-246
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000144
Family HAMP domain 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|386039668|ref|YP_005958622.1|
Domain Number - Region: 78-173
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00275
Family Fibrinogen coiled-coil and central regions 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039668|ref|YP_005958622.1|
Sequence length 483
Comment two-component sensor histidine kinase [Paenibacillus polymyxa M1]
Sequence
MTIRKKLLLFIPLLVVFANIIAYFVFQSGKVVQQSYNEMLGRILLIEQTSESAEGNLNLL
YAYLLNPRDDKDVQGLTEYQLKQLKGRIQEVSDSTDPSFAEEDYMNLLATFLEQKQAAVL
DAKAQDPQSAFEHYIEAEKTVSYIHEEGQRLIDAELAYYRPIIENIRNKNEQMNGLGMAL
FGMNALMGVLLAIWISRSITGPVGRLVRLAKRIATGDLNIEPQPQPRRDDELGVLADAIS
QMSADLSILIEKDKQSLEMRRLVKELELLALQNQINPHFLFNTLNVLSKLAILEGAEKTS
DLIVSLSNLLRYSLQKLDKPVTLQEELNHINEYVTIQQARFRDRICFDLHFDASVLQQQI
PALTIQPFIENAFLHGVADMENGAIITLTLSRAGEDVQIEISDNGKGMTEETRLSVLRLE
GGAESSSSTGLGMQNVFRRLQLFYEKEGMVEIRSHTGLGTTITIRIPVKKESEQTNVSVV
DRG
Download sequence
Identical sequences E3EEC1
gi|310640527|ref|YP_003945285.1| gi|386039668|ref|YP_005958622.1| WP_013369677.1.14980 WP_013369677.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]