SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039712|ref|YP_005958666.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039712|ref|YP_005958666.1|
Domain Number 1 Region: 474-632
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.43e-20
Family Histidine kinase 0.019
Further Details:      
 
Domain Number 2 Region: 356-405
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000126
Family HAMP domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039712|ref|YP_005958666.1|
Sequence length 666
Comment two-component sensor kinase YesM [Paenibacillus polymyxa M1]
Sequence
MMPRLRLRNMPLRYQLMVLFLLFGIVPSLGLGLLVNWTVERIIERQVENHTMQLIGKVNE
ALDTKMENLQNMTYLVAFNPDIGEFWKGRTLADGHAGHTSGATPENQGKQAQQPLLNQAP
GSKQAVSSVQEQDTLYEMKQFLQGFTTLYPEIAGILIVNEKGDYISNEMYARSTRSLTEE
DWYTQAAQHAGIFTVLGQPSHRNVTTHVRYKDSEIVSVVRSVTDPETGHVLGVIMIDLKL
RAVSQAARDVTLGKSGYVMVTDAKGRSVYMPDMPLIERIPPQWFGTEDSGMFTREAGGRE
LLFMFQASEFTGWRTVGVFPARESTLEVRQIQFYVVCFVFIVCLFGLTASLRLSSSIAQP
IFRLMSYMRKAETGDLTVRQWSERGDEIGMLGRSFNRMLEQIRRLMLLSELRERQKRDAE
LRSLQEHIKPHFLYNTLDTIHWMARKNGADDVSDMVGALSKLFRLGLSKGDDFISLRSEV
EHITSYMQIQQTRYRDRLRWELNVPDELKDLFVLKLMLQPVVENAIYHGIKARRGPGTIC
VEAKAEDGKLLLTVRDDGAGMTAERLCELREWLERPLEAMEGRRKQKEVRTNGRSYGMLN
VQARIRLSFGEEYGITLDSKEGTGTCVTITHPLLLDMAQLKKPYDKGEGQDDEIQGNRQR
DNGESD
Download sequence
Identical sequences E3EFD8
gi|310640584|ref|YP_003945342.1| WP_013369734.1.14980 WP_013369734.1.91857 gi|386039712|ref|YP_005958666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]