SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039857|ref|YP_005958811.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039857|ref|YP_005958811.1|
Domain Number 1 Region: 51-249
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.45e-65
Family NodB-like polysaccharide deacetylase 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039857|ref|YP_005958811.1|
Sequence length 262
Comment polysaccharide deacetylase, putative [Paenibacillus polymyxa M1]
Sequence
MKYNRLLCAGIAVSLLCISSCPTAYTNAQNTSYASPAPTKGRAYYEERGDIVWEVPTHRK
LIALTFDDGPDESNTPAILDLLQKYDAKATFFVVGSRVEKLPHLVKREREEGHEVGNHTF
LHSSFQYISRNKALSELDQGQTSIVQATGAGTHLFRPPGGSYNDSLVKLSKEKGLKIILW
SWHQDTLDWRKPGVHRIADKVLRNARNGDIVLMHDYVHQSTQTVEALKIILPELKKRGYS
FVTVSELLSNREKPDGLIEVNK
Download sequence
Identical sequences E3EIE8
gi|386039857|ref|YP_005958811.1| gi|310640744|ref|YP_003945502.1| WP_013369892.1.14980 WP_013369892.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]