SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386040990|ref|YP_005959944.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386040990|ref|YP_005959944.1|
Domain Number 1 Region: 490-591
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000017
Family Histidine kinase 0.018
Further Details:      
 
Domain Number 2 Region: 329-379
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000196
Family HAMP domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386040990|ref|YP_005959944.1|
Sequence length 602
Comment two-component sensor kinase YesM [Paenibacillus polymyxa M1]
Sequence
MNILSLARKWFGRLRFKSKVIAVFLPLIIISLLILGLVSNQLFSRSLIEQTTSNVVDESQ
LILSRTDYIFSSVETAANIMVTNINRMYDSYGARPDTAMDRVQFGNLMQSRLSIDLSIFR
EVDAAVFIDTEGTIFASYTESGDDSKVDSMLKRVRESESYGQALWFDMEKRDFLTPDPNS
PVLTLGKMVINIDTGDPYGTLFLLVKEEGLSDYFRSSDPDTNKSYYFLDNEMRVAVAEDN
GMLMKPVSSQLAEAIQGCGSNVSPKTCSFEDGGNLVTVNDYNRMGWKLVNIVSLSLLTAD
VRQNVRLSLLIGVFCLAFSWLGASFLSKMVVSPLEQLTRAMRKVVTGDLQSVATVRTEDE
IGTIAEAFNFMIRRIRELLDEVRQEQNRKREYELALMTAQIKPHFLYNTLDTIYALNELD
RNDEARDTTKALADFYRMVLNKGRELIILEKEAQITDDYLTILQIRYPDVFRYEVDIPSE
LAGTPIPKLSLQPLVENSIYHGLKKKGTKGFIRIFAFKQNDRVIVRVEDNGVGMNEVQVQ
NIMSRHLPKEGIRSIGTYSVQQRLSLYFGEEYGISVQSVLGEGTIVDLSLPTLPKGSEHQ
DV
Download sequence
Identical sequences E3EJH7
WP_014599749.1.14980 WP_014599749.1.31500 WP_014599749.1.91857 WP_014599749.1.99789 gi|386040990|ref|YP_005959944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]