SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386041265|ref|YP_005960219.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041265|ref|YP_005960219.1|
Domain Number 1 Region: 65-262
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.94e-66
Family NodB-like polysaccharide deacetylase 0.0000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386041265|ref|YP_005960219.1|
Sequence length 268
Comment polysaccharide deacetylase, putative [Paenibacillus polymyxa M1]
Sequence
MRYRGVLPCLALLLAFSSFPVHADTPPNIGTPHPKEAAAATSVYQSKDRATPTLAMLRKK
HADIFKMCGPHTRQIALTFDDVPDSRYTPQVLDVLHANGIKATFFIVGHRAEKHPGIIRR
IIREGHAIGNHSYTHPDFRKATPERFRHQITKTERILEASIGFRPRLIRPPYGEITEPQI
QWARRHGYMIVNWNVDSLDWKGLSKTQIQRNVIPATRPGSIILMHAGGGQSSNLQGTVQA
LPGLIHSLKAKGYKFVTVPRLLHTSERK
Download sequence
Identical sequences E3E7M5
WP_013371433.1.14980 WP_013371433.1.91857 gi|310642313|ref|YP_003947071.1| gi|386041265|ref|YP_005960219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]