SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386041309|ref|YP_005960263.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041309|ref|YP_005960263.1|
Domain Number 1 Region: 35-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000147
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386041309|ref|YP_005960263.1|
Sequence length 299
Comment ran-binding protein 10 [Paenibacillus polymyxa M1]
Sequence
MKKLLPILLSLFLLPWFSQITHAATPESISLIPVMKNDTTPSGKISYSAARSGLEGYRAF
DGKPNYSTDGTYSAWGTAPQSGWLAYEFPTPKIVTKYVLYYGGYSTNRPPDAGKDMPNTW
TFEGSNDGKNWTVLDNKAEYIFTEGANEFSLKNKDQFKTYRINITKNNGATGKDVNLAIH
EMEMWGYDPATQTPDPVDPTPSPNPDPSNPTDPTEPTQPTGDRAILTITMDTGLEKEFDL
SMKEINSFISWYEAKQAGSGTASYAIDKHNNNKGPFSNRKDYVIFNKILTFEVSEYSTK
Download sequence
Identical sequences WP_014599818.1.91857 gi|386041309|ref|YP_005960263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]