SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386041397|ref|YP_005960351.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041397|ref|YP_005960351.1|
Domain Number 1 Region: 117-206
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000683
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386041397|ref|YP_005960351.1|
Sequence length 299
Comment kelch-like protein 4 [Paenibacillus polymyxa M1]
Sequence
MRENGVFAFVPSDEPDQAYKGGYYYSKDKGATISFAFTGEKLRVLAPVWTLQSNNIEVNI
DGVKIMNYSAYGSPVKHRVILFEKLNLDKGKHIVKLTNNQAGKEFEVDAIDIAEDGELLP
INAPFNLDASAGDSKVTLKWDQIENAESYTVKYGTESGKYTETATATKDAYGNFIIPDLT
NGTKYYFVVSAKVNSVDSEYSNEASAAPQGGGGQTDPEQPTGNRAILVVTMTTGLEKEFD
LSMKEVNDFIAWYEGKQAGSGSASYAINKHDNNKGPFSSRKDYMLYDRILTFEVSEYSK
Download sequence
Identical sequences E3E4K9
WP_014599885.1.13814 WP_014599885.1.14980 WP_014599885.1.91857 gi|386041397|ref|YP_005960351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]